| Edit |   |
| Antigenic Specificity | Chromosome 14 Open Reading Frame 80 (C14ORF80) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The specific function of C14orf80 is not yet known. |
| Immunogen | C14 ORF80 antibody was raised using the N terminal Of C14 rf80 corresponding to a region with amino acids MLAQARVPLGDEMTVCQIHLYTRGCHSDQSLSHLSVTEAEMLRDPEGGQQ |
| Other Names | n/a |
| Gene, Accession # | Gene ID: 283643 |
| Catalog # | ABIN632833 |
| Price | |
| Order / More Info | Chromosome 14 Open Reading Frame 80 (C14ORF80) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |