| Edit |   |
|---|
| Antigenic Specificity | Chromosome 17 Open Reading Frame 48 (C17orf48) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | C17ORF48 hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second-messenger role of ADP-ribose, which activates TRPM2 as a mediator of oxidative/nitrosative stress. |
|---|
| Immunogen | C17 ORF48 antibody was raised using the N terminal Of C17 rf48 corresponding to a region with amino acids MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLL |
|---|
| Other Names | 2310004I24Rik|MDS006|C17orf48|NBLA03831|C19H17orf48|ADPRibase-Mn|RGD1309906|c17orf48|mds006 |
|---|
| Gene, Accession # | Gene ID: 56985 |
|---|
| Catalog # | ABIN632213 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 17 Open Reading Frame 48 (C17orf48) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|