| Edit |   |
|---|
| Antigenic Specificity | Chromosome 19 Open Reading Frame 24 (C19orf24) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | C19orf24 is a novel human non-classical secreted protein which is encoded by the hypothetical gene C19orf24 (chromosome 19 open reading frame 24). The exact function of C19orf24 remains unknown. |
|---|
| Immunogen | C19 ORF24 antibody was raised using the N terminal Of C19 rf24 corresponding to a region with amino acids MREGQEMGPTPVPSNPLLHRSFPCWPRGWSHPVPTRELLLEPAQPADLLP |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | Gene ID: 55009 |
|---|
| Catalog # | ABIN633528 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 19 Open Reading Frame 24 (C19orf24) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|