| Edit |   |
|---|
| Antigenic Specificity | Chromosome 19 Open Reading Frame 46 (C19orf46) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | C19orf46 contributes to the establishment of secretory epithelial morphology by promoting kinesin-dependent apical migration of the centrosome and Golgi apparatus and basal localization of the nucleus. |
|---|
| Immunogen | C19 ORF46 antibody was raised using the N terminal Of C19 rf46 corresponding to a region with amino acids GEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEPAAHPPRWSTPSSYEDPA |
|---|
| Other Names | C19orf46|Nesp4|C18H19orf46|RGD1304580|0610012K07Rik|AI428936 |
|---|
| Gene, Accession # | Gene ID: 163183 |
|---|
| Catalog # | ABIN635247 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 19 Open Reading Frame 46 (C19orf46) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|