| Edit |   |
|---|
| Antigenic Specificity | Chromosome 20 Open Reading Frame 160 (C20orf160) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The specific function of C20orf160 is not yet known. |
|---|
| Immunogen | C20 ORF160 antibody was raised using the N terminal Of C20 rf160 corresponding to a region with amino acids LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLL |
|---|
| Other Names | C20orf160|dJ310O13.5|C20H20orf160 |
|---|
| Gene, Accession # | Gene ID: 140706 |
|---|
| Catalog # | ABIN632706 |
|---|
| Price | |
|---|
| Order / More Info | Chromosome 20 Open Reading Frame 160 (C20orf160) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|