| 产品详情 |
| Edit |   |
| Antigenic Specificity | Bradykinin RB2/BDKRB2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 28757212). |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Bradykinin RB2/BDKRB2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Bradykinin RB2/BDKRB2. This antibody reacts with human. The Bradykinin RB2/BDKRB2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Bradykinin RB2/BDKRB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVE WLGWLNTIQP |
| Other Names | B2 bradykinin receptor, B2R, BK2, BK-2, BK-2 receptor, BKR2, bradykinin receptor B2, BRB2, DKFZp686O088 |
| Gene, Accession # | BDKRB2, Gene ID: 624 |
| Catalog # | NBP2-14351 |
| Price | |
| Order / More Info | Bradykinin RB2/BDKRB2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 28757212, 30427893 |
| 产品资料 |
|
|