| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TSG101 |
|---|
| Clone | 5B7 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, RNA Inhibition. Antibody reactivity against recominant protein and cell lysate for WB. It has been used for IF, IHC-P, RNAi Validation and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TSG101 Antibody (5B7) from Novus Biologicals is a mouse monoclonal antibody to TSG101. This antibody reacts with human. The TSG101 Antibody (5B7) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, RNA Inhibition. |
|---|
| Immunogen | TSG101 (NP_006283 201 a.a. - 280 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQE |
|---|
| Other Names | ESCRT-I complex subunit TSG101, TSG10, tumor susceptibility gene 10, tumor susceptibility gene 101, tumor susceptibility gene 101 protein, tumor susceptibility protein, VPS23 |
|---|
| Gene, Accession # | TSG101, Gene ID: 7251, Accession: NP_006283, SwissProt: NP_006283 |
|---|
| Catalog # | H00007251-M01 |
|---|
| Price | |
|---|
| Order / More Info | TSG101 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23171551, 23844026, 25776846 |
|---|
| 产品资料 |
|
|