| 产品详情 |
| Edit |   |
| Antigenic Specificity | ARP1 Actin-Related Protein 1 Homolog B, Centractin beta (Yeast) (ACTR1B) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | ACTR1B is a 42.3 kDa subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kDa. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. ACTR1B, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex. |
| Immunogen | ACTR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids VGPARFRAPELLFQPDLVGDESEGLHEVVAFAIHKSDMDLRRTLFANIVL |
| Other Names | ACTR1B|ARP1B|CTRN2|PC3|Actr1b|hm:zehn1110|wu:fc22g09|wu:fc56d01|wu:fy52e08|zehn1110|zgc:56317|2310066K23Rik|AA960180|AI851923|Arp1b |
| Gene, Accession # | Gene ID: 10120 |
| Catalog # | ABIN632625 |
| Price | |
| Order / More Info | ARP1 Actin-Related Protein 1 Homolog B, Centractin beta (Yeast) (ACTR1B) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |
| 产品资料 |
|
|