| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Coronin-1a |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Coronin-1a Antibody from Novus Biologicals is a rabbit polyclonal antibody to Coronin-1a. This antibody reacts with human. The Coronin-1a Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Coronin-1a antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRL DRLEETVQA |
|---|
| Other Names | clipin-A, CLIPINA, CORO1, coronin, actin binding protein, 1A, coronin, actin-binding protein, 1A, coronin-1, coronin-1A, Coronin-like protein A, Coronin-like protein p57, FLJ41407, HCORO1, MGC117380, p57, TACOCLABP, Tryptophan aspartate-containing coat protein |
|---|
| Gene, Accession # | CORO1A, Gene ID: 11151 |
|---|
| Catalog # | NBP2-13861 |
|---|
| Price | |
|---|
| Order / More Info | Coronin-1a Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|