| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Plexin A3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Plexin A3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Plexin A3. This antibody reacts with human. The Plexin A3 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Plexin A3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSLDAGSRVTVTVRDSECQFVRRDAKAIVCISPLSTLGPSQAPITLAIDRANISSPGLIYTYTQDPTVTRLEPTWSIINGSTA |
|---|
| Other Names | HSSEXGENE, plexin A3, Plexin-4, plexin-A3, PLXN3, PLXN4, Semaphorin receptor SEX, Sex chromosome X transmembrane protein of HGF receptor family 3, SEXPLEXIN-A3,6.3, XAP-6 |
|---|
| Gene, Accession # | PLXNA3, Gene ID: 55558 |
|---|
| Catalog # | NBP2-56699 |
|---|
| Price | |
|---|
| Order / More Info | Plexin A3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|