| Edit |   |
|---|
| Antigenic Specificity | Plexin A4 (PLXNA4) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This protein mediates semaphorin receptor activity. |
|---|
| Immunogen | Plexin A4 antibody was raised using the middle region of PLXNA4 corresponding to a region with amino acids TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV |
|---|
| Other Names | D204|wu:fd49b01|wu:fe15f03|PLXNA4A|FAYV2820|PLEXA4|PLXNA4B|PRO34003|9330117B14|Plxa4|mKIAA1550|PLEX2|Plxna4|PLXNA4 |
|---|
| Gene, Accession # | Gene ID: 91584 |
|---|
| Catalog # | ABIN633960 |
|---|
| Price | |
|---|
| Order / More Info | Plexin A4 (PLXNA4) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|