| 产品详情 |
| Edit |   |
| Antigenic Specificity | TSGA2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TSGA2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TSGA2. This antibody reacts with human. The TSGA2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TSGA2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTL |
| Other Names | Cancer/testis antigen 79, CT79, FLJ32753, h-meichroacidin, Male meiotic metaphase chromosome-associated acidic protein, Meichroacidin, radial spoke head 1 homolog, radial spoke head 1 homolog (Chlamydomonas), RSP44, RSPH10A, testes specific A2 homolog, testes specific gene A2 homolog, testis specific A2 homolog, testis specific A2 homolog (mouse), Testis-specific gene A2 protein, TSA2MGC126568, TSGA2MGC141927 |
| Gene, Accession # | RSPH1, Gene ID: 89765 |
| Catalog # | NBP1-89839 |
| Price | |
| Order / More Info | TSGA2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23993197, 24518672 |
| 产品资料 |
|
|