| Edit |   |
|---|
| Antigenic Specificity | GDP-Mannose Pyrophosphorylase A (GMPPA) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | GMPPA is a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides. |
|---|
| Immunogen | GMPPA antibody was raised using the N terminal of GMPPA corresponding to a region with amino acids LKAVILIGGPQKGTRFRPLSFEVPKPLFPVAGVPMIQHHIEACAQVPGMQ |
|---|
| Other Names | gmppa|zgc:66135|gmppab|gmppaa|Afu6g07620|1810012N01Rik |
|---|
| Gene, Accession # | Gene ID: 29926,69080,501167 |
|---|
| Catalog # | ABIN631606 |
|---|
| Price | |
|---|
| Order / More Info | GDP-Mannose Pyrophosphorylase A (GMPPA) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|