| Edit |   |
|---|
| Antigenic Specificity | Carbonyl Reductase 1 (CBR1) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues. |
|---|
| Immunogen | Carbonyl Reductase 1 antibody was raised using the middle region of CBR1 corresponding to a region with amino acids AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ |
|---|
| Other Names | LOC100222525|MGC131152|CBR|SDR21C1|hCBR1|9-KPR|AW261796|CR|Cbr |
|---|
| Gene, Accession # | Gene ID: 873 |
|---|
| Catalog # | ABIN630569 |
|---|
| Price | |
|---|
| Order / More Info | Carbonyl Reductase 1 (CBR1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|