Edit |   |
Antigenic Specificity | GAPDH |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 100ug (sample available) |
Concentration | 500ug/ml. |
Applications | WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit IgG polyclonal Picoband™ antibody for Glyceraldehyde-3-phosphate dehydrogenase(GAPDH) detection. Tested with WB in Human. No cross reactivity with other proteins. Glyceraldehyde 3-phosphate dehydrogenase (abbreviated as GAPDH or less commonly as G3PDH) is an enzyme of ~37kDa that catalyzes the sixth step of glycolysis and thus serves to break down glucose for energy and carbon molecules. This gene encodes a member of the glyceraldehyde-3-phosphate dehydrogenase protein family. GAPDH is mapped to 12p13.31. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The encoded protein has additionally been identified to have uracil DNA glycosylase activity in the nucleus. |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human GAPDH (302-335aa ALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE), different from the related mouse and rat sequences by three amino acids. |
Other Names | Glyceraldehyde-3-phosphate dehydrogenase;GAPDH;1.2.1.12;Peptidyl-cysteine S-nitrosylase GAPDH;2.6.99.-;GAPDH;GAPD;CDABP0047, OK/SW-cl.12; |
Gene, Accession # | GAPDH, UniProt: P04406 |
Catalog # | A00227 |
Price | |
Order / More Info | GAPDH Antibody from BOSTER BIO |
Product Specific References | n/a |