产品详情 |
Edit |   |
Antigenic Specificity | PTPMT1 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human |
Isotype | n/a |
Format | immunogen affinity purified |
Size | 0.1 ml |
Concentration | n/a |
Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | The PTPMT1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PTPMT1. This antibody reacts with human. The PTPMT1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PTPMT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IPTLDNLQKGVQFALKYQSLGQCVYVHCKAGRSRSATMVAAYLIQVHKWS PEEAVRAIAKIRSYIHIRPGQLDVLKEFHKQITARAT |
Other Names | DUSP23, EC 3.1.3.16, EC 3.1.3.48, FLJ46081, MOSPNB4 apoptosis/differentiation related protein, Phosphoinositide lipid phosphatase, PLIPprotein-tyrosine phosphatase mitochondrial 1, protein tyrosine phosphatase, mitochondrial 1, PTEN-like phosphatase |
Gene, Accession # | PTPMT1, Gene ID: 114971 |
Catalog # | NBP2-13827 |
Price | |
Order / More Info | PTPMT1 Antibody from NOVUS BIOLOGICALS, LLC |
Product Specific References | n/a |
产品资料 |
|
|