| Edit |   |
|---|
| Antigenic Specificity | Glutaredoxin 5 (GLRX5) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Defects in GLRX5 are the cause of anemia sideroblastic pyridoxine-refractory autosomal recessive (PRARSA). The specific function of GLRX5 is not yet known. |
|---|
| Immunogen | GLRX5 antibody was raised using the middle region of GLRX5 corresponding to a region with amino acids NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG |
|---|
| Other Names | grx5|C14orf87|FLB4739|GRX5|PR01238|PRO1238|RGD1308383|2310004O13Rik|2900070E19Rik|AU020725|id:ibd5119|wu:fa09g08|zgc:73343 |
|---|
| Gene, Accession # | Gene ID: 51218,73046,362776 |
|---|
| Catalog # | ABIN632427 |
|---|
| Price | |
|---|
| Order / More Info | Glutaredoxin 5 (GLRX5) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|