| Edit |   |
|---|
| Antigenic Specificity | Glutaredoxin 3 (GLRX3) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | GLRX3 may play a role in regulating the function of the thioredoxin system. |
|---|
| Immunogen | GLRX3 antibody was raised using the N terminal of GLRX3 corresponding to a region with amino acids MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR |
|---|
| Other Names | GLRX4|GRX3|GRX4|PICOT|TXNL2|TXNL3|Txnl2|txnl2|wu:fb38e09|zgc:103648 |
|---|
| Gene, Accession # | Gene ID: 10539 |
|---|
| Catalog # | ABIN632963 |
|---|
| Price | |
|---|
| Order / More Info | Glutaredoxin 3 (GLRX3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|