| Edit |   |
|---|
| Antigenic Specificity | Glutaredoxin 1 (GRX1) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | GLRX has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. It reduces low molecular weight disulfides and proteins. |
|---|
| Immunogen | GLRX antibody was raised using a synthetic peptide corresponding to a region with amino acids IKQGLLEFVDITATNHTNEIQDYLQQLTGARTVPRVFIGKDCIGGCSDLV |
|---|
| Other Names | grx|grx1|GLRX|GLRXP3|GLRXL|ATGRX2|CAX-interacting protein 2|F16M14.20|F16M14_20|GLUTAREDOXIN|ATGRXCP|CAX interacting protein 1|TTase|Grx1|Glrx1|C86710|D13Wsu156e|GRX|GRX1|wu:fc38f02|zgc:103707|GLRX1|TTF|Grx |
|---|
| Gene, Accession # | Gene ID: 2745,93692,64045 |
|---|
| Catalog # | ABIN632220 |
|---|
| Price | |
|---|
| Order / More Info | Glutaredoxin 1 (GRX1) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|