| Edit |   |
|---|
| Antigenic Specificity | Glutaryl-CoA Dehydrogenase (GCDH) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | GCDH belongs to the acyl-CoA dehydrogenase family. It catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and CO(2) in the degradative pathway of L-lysine, L-hydroxylysine, and L-tryptophan metabolism. It uses electron transfer flavoprotein as its electron acceptor. The enzyme exists in the mitochondrial matrix as a homotetramer of 45 kDa subunits. |
|---|
| Immunogen | GCDH antibody was raised using the N terminal of GCDH corresponding to a region with amino acids SLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRA |
|---|
| Other Names | ACAD5|GCD|zgc:56505|zgc:77704|9030411L18|AI266902|D17825 |
|---|
| Gene, Accession # | Gene ID: 2639,270076 |
|---|
| Catalog # | ABIN630975 |
|---|
| Price | |
|---|
| Order / More Info | Glutaryl-CoA Dehydrogenase (GCDH) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|