| 产品详情 |
| Edit |   |
| Antigenic Specificity | Methionine Aminopeptidase 1D/MAP1D |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Methionine Aminopeptidase 1D/MAP1D Antibody from Novus Biologicals is a rabbit polyclonal antibody to Methionine Aminopeptidase 1D/MAP1D. This antibody reacts with human. The Methionine Aminopeptidase 1D/MAP1D Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Methionine Aminopeptidase 1D/MAP1D antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VGNVDECGKKLVEVARRCRDEAIAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHA |
| Other Names | EC 3.4.11.18, MAP1DCDS of metAP-3 within PCR fragment, Metap1l, methionine aminopeptidase 1D, mitochondrial, methionyl aminopeptidase type 1D (mitochondrial), Methionyl aminopeptidase type 1D, mitochondrial |
| Gene, Accession # | METAP1D, Gene ID: 254042 |
| Catalog # | NBP2-48593 |
| Price | |
| Order / More Info | Methionine Aminopeptidase 1D/MAP1D Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|