| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Methionine Sulfoxide Reductase A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB reported in scientific literature (PMID: 25341044). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Methionine Sulfoxide Reductase A Antibody from Novus Biologicals is a rabbit polyclonal antibody to Methionine Sulfoxide Reductase A. This antibody reacts with human. The Methionine Sulfoxide Reductase A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Methionine Sulfoxide Reductase A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVG |
|---|
| Other Names | cytosolic methionine-S-sulfoxide reductase, EC 1.8.4.11, methionine sulfoxide reductase A, peptide met (O) reductase, Peptide Met(O) reductase, peptide methionine sulfoxide reductase, Peptide-methionine (S)-S-oxide reductase, PMSR, Protein-methionine-S-oxide reductase |
|---|
| Gene, Accession # | MSRA, Gene ID: 4482 |
|---|
| Catalog # | NBP1-87456 |
|---|
| Price | |
|---|
| Order / More Info | Methionine Sulfoxide Reductase A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25341044 |
|---|
| 产品资料 |
|
|