| Edit |   |
| Antigenic Specificity | Methionine Sulfoxide Reductase A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Methionine Sulfoxide Reductase A Antibody from Novus Biologicals is a rabbit polyclonal antibody to Methionine Sulfoxide Reductase A. This antibody reacts with human. The Methionine Sulfoxide Reductase A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry. |
| Immunogen | Synthetic peptides corresponding to MSRA (methionine sulfoxide reductase A) The peptide sequence was selected from the middle region of MSRA)(50ug). Peptide sequence YQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVS. |
| Other Names | cytosolic methionine-S-sulfoxide reductase, EC 1.8.4.11, methionine sulfoxide reductase A, peptide met (O) reductase, Peptide Met(O) reductase, peptide methionine sulfoxide reductase, Peptide-methionine (S)-S-oxide reductase, PMSR, Protein-methionine-S-oxide reductase |
| Gene, Accession # | MSRA, Gene ID: 4482, Accession: Q9UJ68, SwissProt: Q9UJ68 |
| Catalog # | NBP1-57727 |
| Price | |
| Order / More Info | Methionine Sulfoxide Reductase A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |