| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BPTF/FALZ |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BPTF/FALZ Antibody from Novus Biologicals is a rabbit polyclonal antibody to BPTF/FALZ. This antibody reacts with human. The BPTF/FALZ Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human BPTF/FALZ antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TTIASTGQTFQITGNPVTMAGKVITKLPLPANSKIVAVNVPATQGGIVQVHQ |
|---|
| Other Names | bromodomain and PHD domain transcription factor, Bromodomain and PHD finger-containing transcription factor, bromodomain PHD finger transcription factor, EC 3.6.1, EC 6.2.1.5, FAC1fetal Alz-50 reactive clone 1, FALZnucleosome-remodeling factor subunit BPTF, Fetal Alz-50 clone 1 protein, Fetal Alzheimer antigennucleosome remodeling factor, large subunit, NURF301 |
|---|
| Gene, Accession # | BPTF, Gene ID: 2186 |
|---|
| Catalog # | NBP2-57567 |
|---|
| Price | |
|---|
| Order / More Info | BPTF/FALZ Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|