| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PAFAH1B2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PAFAH1B2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PAFAH1B2. This antibody reacts with human, rat. The PAFAH1B2 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: beta |
|---|
| Immunogen | Synthetic peptides corresponding to PAFAH1B2(platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa) The peptide sequence was selected from the N terminal of PAFAH1B2. Peptide sequence MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLD |
|---|
| Other Names | EC 3.1.1.47, intracellular platelet-activating factor acetylhydrolase alpha 2 subunit, PAF acetylhydrolase 30 kDa subunit, PAF-AH 30 kDa subunit, PAFAH subunit beta, PAF-AH subunit beta, PAF-AH1b alpha 2 subunit, PAFAHB, platelet-activating factor acetylhydrolase 1b, catalytic subunit 2 (30kDa), platelet-activating factor acetylhydrolase IB subunit beta, platelet-activating factor acetylhydrolase, isoform Ib, beta subunit 30kDa, platelet-activating factor acetylhydrolase, isoform Ib, subunit 2 (30kDa) |
|---|
| Gene, Accession # | PAFAH1B2, Gene ID: 5049, Accession: O35264 |
|---|
| Catalog # | NBP1-56301 |
|---|
| Price | |
|---|
| Order / More Info | PAFAH1B2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|