| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PAFAH1B3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PAFAH1B3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PAFAH1B3. This antibody reacts with human. The PAFAH1B3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human PAFAH1B3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KAIVQLVNERQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHS |
|---|
| Other Names | EC 3.1.1.47, FLJ44990, PAF acetylhydrolase 29 kDa subunit, PAF-AH 29 kDa subunit, PAFAH subunit gamma, PAF-AH subunit gamma, PAF-AH1b alpha 1 subunit, PAFAHG, platelet-activating factor acetylhydrolase 1b, catalytic subunit 3 (29kDa), platelet-activating factor acetylhydrolase IB subunit gamma, platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit (29kD), platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit 29kDa, platelet-activating factor acetylhydrolase, isoform Ib, subunit 3 (29kDa) |
|---|
| Gene, Accession # | PAFAH1B3, Gene ID: 5050 |
|---|
| Catalog # | NBP1-86305 |
|---|
| Price | |
|---|
| Order / More Info | PAFAH1B3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|