| Edit |   |
|---|
| Antigenic Specificity | BCL7B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BCL7B Antibody from Novus Biologicals is a rabbit polyclonal antibody to BCL7B. This antibody reacts with human. The BCL7B Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human BCL7B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LTKEEPVPLETQVVEEEEDSGAPPLKRFCVDQPTVPQTASES |
|---|
| Other Names | Allergen Hom s 3, B-cell CLL/lymphoma 7 protein family member B, B-cell CLL/lymphoma 7B |
|---|
| Gene, Accession # | BCL7B, Gene ID: 9275, Accession: Q9BQE9, SwissProt: Q9BQE9 |
|---|
| Catalog # | NBP2-34097 |
|---|
| Price | |
|---|
| Order / More Info | BCL7B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|