| 产品详情 |
| Edit |   |
| Antigenic Specificity | UDP Glucuronosyltransferase 1 Family, Polypeptide A7 (UGT1A7) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | UGT1A7 is an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols. |
| Immunogen | UGT1 A7 antibody was raised using the N terminal of µgT1 7 corresponding to a region with amino acids VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN |
| Other Names | UGT1A10|UGT1A6|UGT1A7|UGT1A8|UGT1A9|UDPGT|UDPGT 1-7|UGT-1G|UGT1-07|UGT1.7|UGT1G|Ugt1|Ugt1a7|Ugt1a8 |
| Gene, Accession # | Gene ID: 54577 |
| Catalog # | ABIN635878 |
| Price | |
| Order / More Info | UDP Glucuronosyltransferase 1 Family, Polypeptide A7 (UGT1A7) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |
| 产品资料 |
|
|