| Edit |   |
|---|
| Antigenic Specificity | UDP Glucuronosyltransferase 2 Family, Polypeptide B15 (UGT2B15) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. UGT2B8 demonstrates reactivity with estriol. |
|---|
| Immunogen | UGT2 B15 antibody was raised using the N terminal of µgT2 15 corresponding to a region with amino acids IKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYY |
|---|
| Other Names | UGT2B28|UGT2B15|UGT2B4|HLUG4|UDPGT 2B8|UDPGT2B15|UDPGTH3|UGT2B8|Ugt2b12|Ugt2b36|Ugt2b4 |
|---|
| Gene, Accession # | Gene ID: 7366 |
|---|
| Catalog # | ABIN636105 |
|---|
| Price | |
|---|
| Order / More Info | UDP Glucuronosyltransferase 2 Family, Polypeptide B15 (UGT2B15) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|