| Edit |   |
|---|
| Antigenic Specificity | UDP Glucuronosyltransferase 2 Family, Polypeptide B4 (UGT2B4) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | UGT2B4 belongs to the UDP-glycosyltransferase family. UDPGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme is active on polyhydroxylated estrogens (such as estriol, 4-hydroxyestrone and 2-hydroxyestriol) and xenobiotics. |
|---|
| Immunogen | UGT2 B4 antibody was raised using the N terminal of µgT2 4 corresponding to a region with amino acids NIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFE |
|---|
| Other Names | HLUG25|UDPGTH1|UGT2B11|UDPGT2B4|UGT2B28|UGT2B15|UGT2B4|UGT2B7|UGT2B17 |
|---|
| Gene, Accession # | Gene ID: 7363 |
|---|
| Catalog # | ABIN636004 |
|---|
| Price | |
|---|
| Order / More Info | UDP Glucuronosyltransferase 2 Family, Polypeptide B4 (UGT2B4) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|