| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KCC4/SLC12A7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KCC4/SLC12A7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KCC4/SLC12A7. This antibody reacts with human, mouse, rat. The KCC4/SLC12A7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human KCC4/SLC12A7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDLFSMKPDQSNV |
|---|
| Other Names | DKFZp434F076, KCC4Electroneutral potassium-chloride cotransporter 4, K-Cl cotransporter 4, potassium/chloride transporter KCC4, solute carrier family 12 (potassium/chloride transporters), member 7, solute carrier family 12 member 7 |
|---|
| Gene, Accession # | SLC12A7, Gene ID: 10723 |
|---|
| Catalog # | NBP1-85133 |
|---|
| Price | |
|---|
| Order / More Info | KCC4/SLC12A7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|