| 产品详情 |
| Edit |   |
| Antigenic Specificity | KCNE1 |
| Clone | 5B12 |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | IgG1 kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, RNA Inhibition. Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for RNAi Validation and ELISA. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KCNE1 Antibody (5B12) from Novus Biologicals is a mouse monoclonal antibody to KCNE1. This antibody reacts with human. The KCNE1 Antibody (5B12) has been validated for the following applications: Western Blot, ELISA, RNA Inhibition. |
| Immunogen | KCNE1 (NP_000210 67 a.a. - 129 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP |
| Other Names | Delayed rectifier potassium channel subunit IsK, FLJ18426, FLJ38123, IKs producing slow voltage-gated potassium channel subunit beta Mink, ISK, Isk-related subfamily, member 1, JLNS2FLJ94103, LQT2/5, MGC33114, Minimal potassium channel, MinK, potassium voltage-gated channel, Isk-related family, member 1, voltage gated potassiun channel accessory subunit |
| Gene, Accession # | KCNE1, Gene ID: 3753, Accession: NP_000210, SwissProt: NP_000210 |
| Catalog # | H00003753-M01 |
| Price | |
| Order / More Info | KCNE1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 24142691 |
| 产品资料 |
|
|