| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KCNH1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KCNH1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KCNH1. This antibody reacts with human. The KCNH1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human KCNH1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DSCDSGITKSDLRLDNVGEARSPQDRSPILAEVKHSFYPIPEQTLQATVLEVRHELKEDIKALNAKMTNIEKQLSEILRILTSRRSSQSPQELFEISRPQSPES |
|---|
| Other Names | EAG channel 1, EAG1, EAGeag1, Ether-a-go-go potassium channel 1, ether-a-go-go, Drosophila, homolog of, hEAG1, h-eageag, Kv10.1, MGC142269, potassium channel, voltage-gated, subfamily H, member 1, potassium voltage-gated channel subfamily H member 1, potassium voltage-gated channel, subfamily H (eag-related), member 1, Voltage-gated potassium channel subunit Kv10.1 |
|---|
| Gene, Accession # | KCNH1, Gene ID: 3756 |
|---|
| Catalog # | NBP2-58376 |
|---|
| Price | |
|---|
| Order / More Info | KCNH1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|