| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KCNJ1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, rat |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 29767556). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KCNJ1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KCNJ1. This antibody reacts with human, rat. The KCNJ1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human KCNJ1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: STSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETD |
|---|
| Other Names | ATP-regulated potassium channel ROM-K, ATP-sensitive inward rectifier potassium channel 1, inwardly rectifying K+ channel, Kir1.1, potassium inwardly-rectifying channel, subfamily J, member 1, ROMK1inwardly rectifying subfamily J member 1 |
|---|
| Gene, Accession # | KCNJ1, Gene ID: 3758, Accession: P48048, SwissProt: P48048 |
|---|
| Catalog # | NBP1-82874 |
|---|
| Price | |
|---|
| Order / More Info | KCNJ1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23940364, 29767556 |
|---|
| 产品资料 |
|
|