| 产品详情 |
| Edit |   |
| Antigenic Specificity | KCNJ10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KCNJ10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KCNJ10. This antibody reacts with human. The KCNJ10 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV |
| Other Names | ATP-dependent inwardly rectifying potassium channel Kir4.1, ATP-sensitive inward rectifier potassium channel 10, BIRK-10, glial ATP-dependent inwardly rectifying potassium channel KIR4.1, Inward rectifier K(+) channel Kir1.2, inward rectifier K+ channel KIR1.2, KCNJ13-PEN, KIR1.2, Kir4.1, Potassium channel, inwardly rectifying subfamily J member 10, potassium inwardly-rectifying channel, subfamily J, member 10, SESAME |
| Gene, Accession # | KCNJ10, Gene ID: 3766 |
| Catalog # | NBP2-62724 |
| Price | |
| Order / More Info | KCNJ10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|