| Edit |   |
|---|
| Antigenic Specificity | BMP-9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BMP-9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BMP-9. This antibody reacts with human. The BMP-9 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to GDF2(growth differentiation factor 2) The peptide sequence was selected from the middle region of GDF2 (NP_057288). Peptide sequence CFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDM. |
|---|
| Other Names | BMP9BMP-9Bone morphogenetic protein 9, GDF-2, growth differentiation factor 2, growth/differentiation factor 2 |
|---|
| Gene, Accession # | GDF2, Gene ID: 2658, Accession: Q9UK05, SwissProt: Q9UK05 |
|---|
| Catalog # | NBP1-59308 |
|---|
| Price | |
|---|
| Order / More Info | BMP-9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 18309101 |
|---|