| Edit |   |
|---|
| Antigenic Specificity | MEF2D |
|---|
| Clone | 4D6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MEF2D Antibody (4D6) from Novus Biologicals is a mouse monoclonal antibody to MEF2D. This antibody reacts with human. The MEF2D Antibody (4D6) has been validated for the following applications: Western Blot. |
|---|
| Immunogen | MEF2D (NP_005911.1 256 a.a. - 351 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. THSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFS |
|---|
| Other Names | DKFZp686I1536, MADS box transcription enhancer factor 2, polypeptide D (myocyte enhancerfactor 2D), MEF2D/DAZAP1 fusion, myocyte enhancer factor 2D, myocyte enhancer factor 2D/deleted in azoospermia associated protein 1 fusionprotein, myocyte-specific enhancer factor 2D |
|---|
| Gene, Accession # | MEF2D, Gene ID: 4209, Accession: NP_005911, SwissProt: NP_005911 |
|---|
| Catalog # | H00004209-M01 |
|---|
| Price | |
|---|
| Order / More Info | MEF2D Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|