| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Pentraxin 3/TSG-14 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Pentraxin 3/TSG-14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Pentraxin 3/TSG-14. This antibody reacts with human. The Pentraxin 3/TSG-14 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Pentraxin 3/TSG-14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS |
|---|
| Other Names | alpha-induced protein 5, pentaxin-related gene, rapidly induced by IL-1 beta, tumor necrosis factor, Pentaxin-related protein PTX3, pentraxin 3, long, pentraxin-3, pentraxin-related gene, rapidly induced by IL-1 beta, pentraxin-related protein PTX3, TNF alpha-induced protein 5, TNFAIP5, TSG14, TSG-14pentaxin-related gene, rapidly induced by IL-1 beta, Tumor necrosis factor alpha-induced protein 5, tumor necrosis factor, alpha-induced protein 5, Tumor necrosis factor-inducible gene 14 protein, tumor necrosis factor-inducible protein TSG-14 |
|---|
| Gene, Accession # | PTX3, Gene ID: 5806 |
|---|
| Catalog # | NBP2-49595 |
|---|
| Price | |
|---|
| Order / More Info | Pentraxin 3/TSG-14 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|