| 产品详情 |
| Edit |   |
| Antigenic Specificity | TRPV6 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TRPV6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRPV6. This antibody reacts with human. The TRPV6 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TRPV6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SPHLSLPMPSVSRSTSRSSANWERLRQGTLRRDLRGIINRGLEDGESWEYQ |
| Other Names | ABP/ZF, calcium channel CaT1, Calcium transport protein 1, CaT1, CaT-L, CATL, CaT-like, ECaC2, ECAC2caT-L, epithelial apical membrane calcium transporter/channel CaT1, Epithelial calcium channel 2Alu-binding protein with zinc finger domain, HSA277909, LP6728, transient receptor potential cation channel subfamily V member 6, transient receptor potential cation channel, subfamily V, member 6, TrpV6, ZFAB |
| Gene, Accession # | TRPV6, Gene ID: 55503 |
| Catalog # | NBP2-32372 |
| Price | |
| Order / More Info | TRPV6 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|