| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TRUSS |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRUSS Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRUSS. This antibody reacts with human. The TRUSS Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human TRUSS antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ESSFRFWQARAVESFLRGTTSYADQMFLLKRGLLEHILYCIVDSECKSRDVLQSYFDLLGELMKFNVDAFKRFNKYINTDAKFQVFLKQINS |
|---|
| Other Names | C20orf188, dJ756N5.2, DKFZp586C1223, DKFZP727M231, Protein TAP1, Protein TRUSS, short transient receptor potential channel 4 associated protein, short transient receptor potential channel 4-associated protein, TNF-receptor ubiquitous scaffolding/signaling protein, transient receptor potential cation channel, subfamily C, member 4 associatedprotein, Trp4-associated protein, Trpc4-associated protein, TRRP4APchromosome 20 open reading frame 188, TRUSS, tumor necrosis factor receptor-associated ubiquitous scaffolding and signalingprotein |
|---|
| Gene, Accession # | TRPC4AP, Gene ID: 26133 |
|---|
| Catalog # | NBP2-57776 |
|---|
| Price | |
|---|
| Order / More Info | TRUSS Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|