| Edit |   |
|---|
| Antigenic Specificity | TRXR3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TRXR3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRXR3. This antibody reacts with human. The TRXR3 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is TRXR3 - middle region. Peptide sequence NHISSLNWGYRLSLREKAVAYVNSYGEFVEHHKIKATNKKGQETYYTAAQ. |
|---|
| Other Names | TGR, thioredoxin reductase 3, TR2, TRXR3 |
|---|
| Gene, Accession # | TXNRD3, Gene ID: 114112, Accession: NP_001166984, SwissProt: NP_001166984 |
|---|
| Catalog # | NBP1-98287-20ul |
|---|
| Price | |
|---|
| Order / More Info | TRXR3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|