| Edit |   |
| Antigenic Specificity | TRXR3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TRXR3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRXR3. This antibody reacts with human. The TRXR3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | The immunogen for this antibody is TRXR3 - middle region. Peptide sequence NHISSLNWGYRLSLREKAVAYVNSYGEFVEHHKIKATNKKGQETYYTAAQ. |
| Other Names | TGR, thioredoxin reductase 3, TR2, TRXR3 |
| Gene, Accession # | TXNRD3, Gene ID: 114112, Accession: NP_001166984, SwissProt: NP_001166984 |
| Catalog # | NBP1-98287 |
| Price | |
| Order / More Info | TRXR3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |