| Edit |   |
|---|
| Antigenic Specificity | SUOX |
|---|
| Clone | 4F2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. Antibody reactivity against recombinant protein on ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SUOX Antibody (4F2) from Novus Biologicals is a mouse monoclonal antibody to SUOX. This antibody reacts with human. The SUOX Antibody (4F2) has been validated for the following applications: ELISA. |
|---|
| Immunogen | SUOX (NP_000447 391 a.a. - 486 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YAWSGGGRAVIRVDVSLDGGLTWQVAKLDGEEQRPRKAWAWRLWQLKAPVPAGQKELNIVCKAVDDGYNVQPDTVAPIWNLRGVLSNAWHRVHVYV |
|---|
| Other Names | EC 1.8.3.1, sulfite oxidase, sulfite oxidase, mitochondrial |
|---|
| Gene, Accession # | SUOX, Gene ID: 6821, Accession: NP_000447, SwissProt: NP_000447 |
|---|
| Catalog # | H00006821-M03 |
|---|
| Price | |
|---|
| Order / More Info | SUOX Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|