| Edit |   |
|---|
| Antigenic Specificity | V-Set and Immunoglobulin Domain-Containing Protein 4 (VSIG4) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | T cell activation by APCs is positively and negatively regulated by members of the B7 family. VSIG4 is a strong negative regulator of murine and human T cell proliferation and IL-2 production. |
|---|
| Immunogen | VSIG4 antibody was raised using the N terminal of VSIG4 corresponding to a region with amino acids VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS |
|---|
| Other Names | DKFZp468O0322|CRIg|Z39IG|A530061A11|BC025105 |
|---|
| Gene, Accession # | Gene ID: 11326 |
|---|
| Catalog # | ABIN630478 |
|---|
| Price | |
|---|
| Order / More Info | V-Set and Immunoglobulin Domain-Containing Protein 4 (VSIG4) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|