| Edit |   |
|---|
| Antigenic Specificity | V-Set and Immunoglobulin Domain Containing 8 (VSIG8) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | VSIG8 contains 2 Ig-like V-type (immunoglobulin-like) domains. VSIG8 is single-pass type I membrane protein. The function of the VSIG8 protein remains unknown. |
|---|
| Immunogen | VSIG8 antibody was raised using the N terminal of VSIG8 corresponding to a region with amino acids HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT |
|---|
| Other Names | A030011M19|EG240916|RGD1562464 |
|---|
| Gene, Accession # | Gene ID: 391123,240916,289236 |
|---|
| Catalog # | ABIN634989 |
|---|
| Price | |
|---|
| Order / More Info | V-Set and Immunoglobulin Domain Containing 8 (VSIG8) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|