| 产品详情 |
| Edit |   |
| Antigenic Specificity | NAP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The NAP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NAP1. This antibody reacts with human. The NAP1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RKARRISVTSKVQADIHDTQAAAADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT |
| Other Names | CG5330, Dmel\CG5330, dNap, dNap1, dNAP-1, MAP3K7IP3, MGC45404, mitogen-activated protein kinase kinase kinase 7 interacting protein 3, Mitogen-activated protein kinase kinase kinase 7-interacting protein 3, Nap-1, NAP1, NF-kappa-B-activating protein 1, NFkB activating protein 1, p56/dCAF-4, TAB-3, TAK1-binding protein 3, TGF-beta activated kinase 1/MAP3K7 binding protein 3, TGF-beta-activated kinase 1 and MAP3K7-binding protein 3, TGF-beta-activated kinase 1-binding protein 3 |
| Gene, Accession # | TAB3, Gene ID: 257397, Accession: Q8N5C8, SwissProt: Q8N5C8 |
| Catalog # | NBP2-33985 |
| Price | |
| Order / More Info | NAP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|