| Edit |   |
|---|
| Antigenic Specificity | Prostaglandin E Synthase 3 (Cytosolic) (PTGES3) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | PTGES3 is a molecular chaperone that localizes to genomic response elements in a hormone-dependent manner and disrupts receptor-mediated transcriptional activation, by promoting disassembly of transcriptional regulatory complexes. |
|---|
| Immunogen | PTGES3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKM |
|---|
| Other Names | PTGES3|P23|TEBP|cPGES|5730442A20Rik|Ptges|Tebp|p23|sid3177|RGD1561913|CPGES |
|---|
| Gene, Accession # | Gene ID: 10728 |
|---|
| Catalog # | ABIN631318 |
|---|
| Price | |
|---|
| Order / More Info | Prostaglandin E Synthase 3 (Cytosolic) (PTGES3) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|