| Edit |   |
|---|
| Antigenic Specificity | UCMA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UCMA Antibody from Novus Biologicals is a rabbit polyclonal antibody to UCMA. This antibody reacts with human. The UCMA Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human UCMA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT |
|---|
| Other Names | C10orf49, chromosome 10 open reading frame 49, Gla-rich protein, GRP, unique cartilage matrix-associated protein, upper zone of growth plate and cartilage matrix associated |
|---|
| Gene, Accession # | UCMA, Gene ID: 221044, Accession: Q8WVF2, SwissProt: Q8WVF2 |
|---|
| Catalog # | NBP2-33469 |
|---|
| Price | |
|---|
| Order / More Info | UCMA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|