| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SP110 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SP110 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SP110. This antibody reacts with human. The SP110 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SP110 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EPQEVSSTPSDKKGKKRKRCIWSTPKRRHKKKSLPGGTASSRHGIQKKLKRVDQVPQKKDDSTCNSTVETRAQKARTECARKSRSEEIIDGTS |
|---|
| Other Names | FLJ22835, IFI41, IFI75, interferon-induced protein 41, 30kD, Interferon-induced protein 41/75, interferon-induced protein 75, 52kD, IPR1, phosphoprotein 41, phosphoprotein 75, SP110 nuclear body protein, Speckled 110 kDa, Transcriptional coactivator Sp110, VODI |
|---|
| Gene, Accession # | SP110, Gene ID: 3431 |
|---|
| Catalog # | NBP1-92426 |
|---|
| Price | |
|---|
| Order / More Info | SP110 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|