| Edit |   |
| Antigenic Specificity | TRAPPC2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TRAPPC2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TRAPPC2. This antibody reacts with human. The TRAPPC2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human TRAPPC2The immunogen for this antibody is TRAPPC2. Peptide sequence RQEDGIKNFFTDVYDLYIKFSMNPFYEPNSPIRSSAFDRKVQFLGKKHLL. |
| Other Names | MIP2A, SEDTlate, trafficking protein particle complex 2 |
| Gene, Accession # | TRAPPC2, Gene ID: 6399, Accession: NP_055378, SwissProt: NP_055378 |
| Catalog # | NBP1-79379-20ul |
| Price | |
| Order / More Info | TRAPPC2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |